PNC-27
Not medical advice. PepTutor summarizes fallible research and community signal for trained practitioners; some compounds are research-only, unapproved, controlled, jurisdiction-dependent, or labeled not for human consumption.
PNC-27 is an experimental anti-cancer peptide built to bind HDM-2 on cancer-cell membranes and punch membrane pores.
No human clinical trial data exists; the only published human case involves massive GI hemorrhage requiring emergency transfusion (6 units PRBC) two days after PNC-27 infusion — causality uncertain but unresolved.
PNC-27 is an experimental anti-cancer peptide built to bind HDM-2 on cancer-cell membranes and punch membrane pores. The useful signal is preclinical: rapid cell-line killing, rodent AML activity, and a mechanism that bypasses p53 mutation and conventional multidrug resistance. It is not validated as a human cancer treatment.
GI hemorrhage (one published case report, causality uncertain), possible immune reaction to non-human penetratin sequence, theoretical off-target membrane disruption in normal cells at high concentrations. Human safety profile entirely uncharacterized by any clinical trial.
No established cost-effectiveness exists because there is no validated human dose, response rate, survival signal, or regulated treatment pathway. The rational comparison is not price per vial; it is clinical-trial access to supervised MDM2/HDM2 oncology programs.
Strongest for mechanism and cell-line cytotoxicity, weak for human usefulness. PNC-27 kills HDM-2-expressing cancer cells quickly in vitro and has animal AML data, but no human efficacy case series, no dose-finding trial, and no published remission signal.
Do not combine with other experimental cancer peptides or cytotoxic agents outside supervised oncology — unpredictable compound interactions with no safety data.
Intro
PNC-27 is a 32-amino-acid synthetic chimeric peptide designed computationally at SUNY Downstate Medical Center around the year 2000.
Its sequence (PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG) combines two functional domains: the first 15 residues are derived from the p53 tumor suppressor protein's MDM-2 binding site (residues 12-26), and the remaining 17 residues are a membrane-penetrating leader sequence (MRP) derived from the Drosophila Antennapedia homeodomain penetratin peptide. The rational design goal was to create a compound that could recognize and bind HDM-2 (human double minute 2, also called MDM-2) expressed on the surface of cancer cells, then use the penetratin domain to insert into and disrupt the membrane.
The underlying biology exploits an oncological anomaly: HDM-2, a protein that normally operates inside cells to regulate p53, is expressed on the outer membrane of many cancer cells but not on the membranes of normal cells. PNC-27 exploits this membrane expression as a selectivity gate. Upon binding to membrane-resident HDM-2, PNC-27 adopts an amphipathic helix-loop-helix conformation and forms transmembrane pores, causing rapid necrotic cell death within minutes to hours. The cell-killing mechanism is physical, not biochemical — it does not require activation of intracellular pathways, p53 function, apoptosis signals, or any cellular process that cancer commonly evolves resistance to.
Preclinical studies demonstrated cytotoxic activity against pancreatic adenocarcinoma (MIA PaCa-2), breast cancer, leukemia cell lines (U937, OCI-AML3, HL-60), melanoma, and cervical cancer cells — all confirmed to express membrane HDM-2. Normal cells lacking surface HDM-2 survived exposure. At 50 mcg/mL in culture, 100% of MIA-PaCa-2 cells were dead within 90 minutes.
Despite compelling in vitro data and some in vivo rodent results, PNC-27 has never entered a human clinical trial. It remains unapproved by the FDA with no established human safety data. The compound is nonetheless marketed online as a non-toxic cancer cure, which is a much stronger claim than the evidence supports. A published medical case report documents a 46-year-old woman with end-stage metastatic cervical cancer who developed massive GI hemorrhage two days after receiving PNC-27, requiring emergency transfusion of 6 units packed red blood cells.
Observed Effects
In vitro cytotoxicity: PNC-27 kills multiple cancer cell lines with high efficiency. At 50 mcg/mL, 100% of MIA-PaCa-2 pancreatic cancer cells were dead within 90 minutes.
Near-complete kill rates were also documented against leukemia cell lines (U937, OCI-AML3, HL-60) and breast cancer lines. Normal, untransformed cells (e.g. MCF-10-2A) survive equivalent PNC-27 exposure — the peptide degrades on their surface without causing membrane disruption.
Cancer type coverage: Confirmed in vitro activity against cancer cells expressing membrane HDM-2: pancreatic adenocarcinoma, breast cancer, AML leukemia subtypes, melanoma, cervical cancer. Coverage is mechanistically determined — any cancer type expressing surface HDM-2 is theoretically susceptible; types that do not express membrane HDM-2 are resistant.
p53-independence: PNC-27 is active against p53-mutant and p53-null cancer cells that are resistant to conventional p53-dependent therapies. Because the kill mechanism (membrane disruption) does not engage intracellular signaling, p53 mutational status is irrelevant. Multidrug resistance gene products (which pump chemotherapy drugs out of cells) also do not affect PNC-27's activity.
In vivo (rodent): PNC-27 at 40 mg/kg intraperitoneal injection once daily for 2-3 weeks showed anti-tumor activity in rodent models. Species and tumor type details are not fully available from accessible sources.
Intracellular mitochondrial disruption: Beyond plasma membrane pore formation, PNC-27 can enter cancer cells and disrupt mitochondrial membranes as a secondary cytotoxic mechanism.
Human data: One published case report — a terminal cancer patient who received PNC-27 and subsequently developed massive GI hemorrhage. No efficacy data in humans is available.
Field Reports
The only documented human experience with PNC-27 is a published medical case report. A 46-year-old woman with end-stage metastatic cervical cancer, having exhausted US treatment options, received experimental PNC-27 treatment by infusion. Two days after the infusion, she presented with massive GI hemorrhage: large-volume hematemesis plus bloody discharge from both urostomy and colostomy. She required IV pantoprazole, octreotide infusion, and 6 units packed red blood cells.
The case report authors — writing partly as a clinical alert — explicitly state they cannot determine whether the hemorrhage was caused by PNC-27 or was coincidental given her end-stage disease. A 46-year-old with metastatic cervical cancer with bowel involvement has multiple independent risk factors for GI hemorrhage, including tumor invasion, coagulopathy, and vessel erosion. The 48-hour temporal association does not establish causation.
The case report was published to make clinicians aware that patients may present to emergency facilities with complications from experimental cancer treatments obtained abroad, particularly treatments marketed online as non-toxic cures. The disconnect between online marketing ('non-toxic potential cure') and the documented clinical reality (serious adverse event in the only published human case) is the core message.
No positive outcome reports, no efficacy case reports, and no systematic self-experimentation logs are available in any accessible evidence base.
Community Consensus
PNC-27's community context is categorically different from the performance, longevity, and recovery compounds in this catalog.
The real-world user population is mostly medically desperate, high-emotion, and medically fragile rather than simply "advanced." The practical consensus is not that PNC-27 has a refined user protocol; it is that unapproved cancer self-treatment is a dangerous substitute for supervised oncology care or regulated clinical-trial enrollment.
Risks & Monitoring
PNC-27 has no human clinical trial safety data. The only published human adverse event is a case report documenting massive GI hemorrhage in a 46-year-old woman with end-stage metastatic cervical cancer, occurring two days after PNC-27 infusion. She required IV pantoprazole, octreotide infusion, and 6 units packed red blood cells. The authors could not definitively establish causality — her advanced metastatic disease with bowel involvement, urostomy, and colostomy provides multiple independent hemorrhage mechanisms — but the 48-hour temporal association is the only human adverse signal in the literature. The case was published as a clinical alert, noting PNC-27 is marketed online as non-toxic.
Three additional safety concerns are theoretically established from preclinical and structural data:
Immune reaction: The penetratin leader sequence (residues 16-32) is derived from Drosophila Antennapedia homeodomain — a non-human protein. Foreign peptide sequences can trigger antibody formation or acute immune reactions. This risk is not quantified from in vitro studies and has not been assessed in any human dosing context.
Off-target membrane disruption: The HDM-2 membrane selectivity is real but not absolute. At sufficiently high concentrations, PNC-27 can disrupt membranes of cells that are not cancer cells. Normal tissues with any residual or low-level HDM-2 surface expression, or cells simply exposed to very high local peptide concentrations, could sustain membrane damage. The dose threshold for off-target effects in vivo is unknown.
Unknown systemic effects: A membranolytic peptide administered systemically (IV or SubQ) distributes throughout the body. Its interaction with endothelial cells, circulating immune cells, and vascular endothelium is not characterized. The GI hemorrhage case, whatever its cause, highlights the potential for unexpected vascular effects.
For Women
Monitoring Panels
REQUIRED is a real safety gate. RECOMMENDED is the prudent default. OPTIONAL covers symptoms, risk factors, or tighter tracking.
Baseline hematologic status essential before any experimental anti-cancer compound; also monitors for hemorrhagic or immune-mediated hematologic changes during use.
Liver function, renal function, and electrolytes must be established before an experimental agent with unknown systemic effects; CMP provides the required safety reference.
Monitor for hematologic changes, immune-mediated cytopenias, or signs consistent with internal hemorrhage (falling hemoglobin).
Hepatotoxicity is not a documented PNC-27 signal, but midcourse LFTs are proportionate for an unapproved systemic peptide with no human pharmacokinetic study.
The only published human case involved massive GI hemorrhage, and many cancer patients have coagulation disruption or anticoagulant exposure; baseline PT/INR and aPTT are a hard precondition in any medically supervised context.
The penetratin sequence is non-human and may trigger immune/inflammatory responses; monitoring CRP and ESR can detect emerging immune reactions.
Avoid With
Do not combine PNC-27 with the following. Sorted highest-severity first.
Why:Additive or synergistic membrane disruption with no safety characterization. Combining cytolytic mechanisms in an uncontrolled setting risks severe off-target tissue destruction.
What to do:No specific interactions documented — this is a broad class caution for any experiment combining PNC-27 with other cytotoxic agents.
Why:The documented GI hemorrhage case (temporal association) plus theoretical vascular endothelial effects mean anticoagulation would increase bleeding severity if PNC-27 does cause vascular injury.
What to do:Many terminal cancer patients are on anticoagulation; this interaction should be considered before any PNC-27 use.
Why:Antiplatelet effects compound any hemorrhagic tendency. Combined with the theoretical vascular effects and the documented GI hemorrhage case, NSAIDs or aspirin should be avoided.
What to do:This includes common OTC pain relievers taken by cancer patients for pain management.
Protocols By Goal
Anti-cancer (preclinical target — no validated human protocol) This is PNC-27's only documented application.
Community protocols use the subcutaneous escalation schedule above (100 mcg/day escalating to 500 mcg/day over 16 weeks). The premise is targeting HDM-2-expressing cancer cells of any type. Without a validated human dose or a way to confirm tumor membrane HDM-2 expression in individual patients outside a research context, protocol optimization is not currently possible.
The only known in vivo reference: 40 mg/kg IP in rodents daily for 2-3 weeks. Scaling to a 70 kg human by body surface area (a rough cross-species conversion) would suggest doses in the range of hundreds of milligrams — far above the community subcutaneous protocols. This discrepancy is unresolved and indicates community doses may be substantially sub-therapeutic, or that subcutaneous bioavailability and tissue distribution differ fundamentally from IP dosing in rodents.
No off-label wellness, performance, or preventive protocols exist or should be constructed for PNC-27. The compound's mechanism (killing HDM-2-expressing cells) has no legitimate application outside active cancer treatment. Healthy adults do not have membrane HDM-2-expressing cells; there is no mechanistic basis for wellness or performance use.
Dosing Details
No authoritative human dosing exists. All protocols described below are theoretical extrapolations from preclinical animal data, explicitly acknowledged as such by their sources. PNC-27 has not completed any Phase 1 human pharmacokinetic or dose-finding study.
In vivo reference (rodent only): 40 mg/kg intraperitoneal once daily for 2-3 weeks in rodent models. This is the only in vivo dose reference. Human equivalent dosing cannot be directly derived from rodent IP dosing.
Community subcutaneous escalation protocol (theoretical): - Weeks 1-2: 100 mcg/day SubQ once daily - Weeks 3-4: 200 mcg/day - Weeks 5-8: 300 mcg/day - Weeks 9-12: 400 mcg/day - Weeks 13-16: 500 mcg/day Cycle length: 8-16 weeks SubQ once daily.
Higher community reference dose: Some sources list 1-2 mg per injection once daily. This is substantially above the conservative escalation protocol and reflects the wide range of extrapolation approaches across community sources.
Reconstitution: Add 3.0 mL bacteriostatic water to a 30 mg vial to yield 10 mg/mL working concentration. At this concentration, 100 mcg = 0.01 mL (1 unit on U-100 insulin syringe); 500 mcg = 0.05 mL. The peptide is highly water-soluble (≥100 mg/mL).
Route: Subcutaneous, abdominal injection preferred. Site rotation (abdomen, thighs, upper arms). Morning administration at consistent time. IV infusion has been used in the case report and in Mexican clinic settings — this route carries higher systemic distribution risk and should not be attempted outside medical supervision.
Storage: Lyophilized powder: -80°C for 2 years; -20°C for 1 year. In solvent: -80°C for 6 months. Protect from moisture.
Critical caveat: These protocols were designed for research and cancer-patient self-experimentation contexts. Using PNC-27 for any indication without oncological supervision is medically irresponsible given the complete absence of human pharmacokinetic and safety data.
Stacks & Alternatives
PNC-27 is not used in combination protocols in the community evidence. Its mechanism (direct membrane disruption) does not complement performance, longevity, or wellness compounds. Cancer treatment stacks with other experimental peptides are not documented.
Alternatives
Stack Cost
Experimental cytotoxic compound — not appropriate for stack analysis in a wellness or performance context; only meaningful within an oncological treatment framework.
PNC-27 is a cytotoxic cancer-targeting agent, not a performance or wellness compound. All risk assessment is in the context of cancer treatment, not health optimization. The immune reaction risk from the penetratin sequence adds a further specialist-level concern.
Anticoagulants and antiplatelet agents are a specific concern given the hemorrhagic adverse event case. Many cancer patients are on anticoagulation — this interaction creates a specialist-level burden.
Baseline CBC, CMP, and coagulation screen are hard gates; follow-up CBC/LFT/inflammatory monitoring is proportionate because the human pharmacology and immune exposure are unknown.
- ·Do not combine with anticoagulants or antiplatelet agents without specialist supervision
- ·Do not combine with other cytotoxic experimental agents
- ·Should only be used within a supervised medical context
- ·Full baseline labs (CBC, CMP, coagulation screen)
- ·Follow-up hematologic, hepatic, and inflammatory monitoring
- ·Access to emergency medical care in case of serious adverse event
- ·Oncology specialist involvement
Experimental cytotoxic anti-cancer compound with documented serious adverse event potential, no human pharmacokinetic data, and no validated dose. Requires oncological context, not individual experimentation.
- ·No cancer diagnosis
- ·Not under oncological care
- ·Using for wellness, performance, or preventive purposes
- ·Anyone with normal health goals
Discontinuation is straightforward — no hormonal suppression or physical dependence. However, monitoring for delayed adverse effects (immune reactions, latent hemorrhagic risk) should continue for at least several days post-cessation.
- ·Delayed immune reaction to penetratin sequence may emerge after stopping
- ·No taper needed but post-cessation monitoring is prudent
Stop immediately, emergency medical evaluation, do not use with anticoagulants. The GI hemorrhage case required IV pantoprazole, octreotide, and 6 units PRBC transfusion.
The non-human penetratin sequence can trigger immune reactions. Pre-treat with antihistamines is not established. Emergency epinephrine access for anaphylaxis.
Most likely outcome given the absence of clinical trial validation; accept null result and discontinue. Tumor may not express adequate surface HDM-2.
Documented hemorrhagic adverse event makes anticoagulation a serious drug-interaction concern
The GI hemorrhage case and theoretical vascular effects create heightened hemorrhage risk in patients with GI tract involvement
There is no mechanistic basis for PNC-27 use in healthy individuals; the cytotoxic mechanism provides no benefit and carries the same unknown risks
Cytotoxic agents are teratogenic by class; no reproductive safety data for PNC-27
Practical Setup
This compound should not be self-administered for cancer treatment. The preclinical data is scientifically interesting but does not establish safety or efficacy in humans.
The only published human experience involved a serious adverse event. Online marketing claims are not supported by clinical evidence.
Regulatory status: FDA-unapproved, with no validated human-use protocol and no regulated treatment pathway. Non-trial access is not equivalent to supervised oncology care.
Handling risk: Laboratory-grade identity and purity controls are not the same as a sterile, approved oncology drug. This article should not be read as a preparation or administration guide.
Drug interactions: Anticoagulants and antiplatelet agents should be assessed carefully given the hemorrhagic adverse event in the case report. See stackingConflicts.
For clinicians: Patients presenting with complications from experimental treatments may not have a medication that appears in standard drug databases. Emergency management of hemorrhage, allergic reaction, or other acute presentations should follow standard protocols and not be delayed pending identification of the experimental agent.
MDM2 inhibitor clinical trials: Patients interested in MDM2/HDM2-targeted therapy should be directed toward legitimate clinical trials for investigational MDM2 inhibitors, where dose, monitoring, and adverse-event reporting are structured.
Mechanism Deep Dive
Chimeric peptide design PNC-27 is a 32-residue chimeric peptide with two functional domains. Residues 1-15 (PPLSQETFSDLWKLL) reproduce the region of human p53 that normally binds to HDM-2 (residues 12-26 of p53, using the p53 numbering). Residues 16-32 (KKWKMRRNQFWVKVQRG) are the membrane-penetrating leader sequence (MRP) derived from the Drosophila Antennapedia homeodomain penetratin peptide. Molecular weight: 4031.73 Da.
HDM-2 membrane expression as selectivity gate HDM-2 (human double minute 2, gene product MDM2) normally functions inside cells as a p53 ubiquitin ligase, targeting p53 for proteasomal degradation. In many cancer cells, HDM-2 is also expressed on the outer plasma membrane — a location not found in normal cells. This differential membrane expression is the entire basis for PNC-27's cancer selectivity. The mechanism does not work if the cancer does not express membrane HDM-2; it does work regardless of intracellular p53 status.
Binding conformation and pore formation X-ray crystallographic and computational energy analyses show that PNC-27's p53-derived residues adopt a 3D conformation directly superimposable on the structure of those same p53 residues when bound to HDM-2. The 1:1 PNC-27:HDM-2 complex forms with the MRP leader sequence extending away from the binding interface. Upon membrane HDM-2 binding, PNC-27 adopts an amphipathic helix-loop-helix configuration and the MRP domain inserts into the lipid bilayer. Multiple PNC-27 molecules cluster at the binding site (confirmed by immuno-scanning electron microscopy showing gold-labeled PNC-27 at membrane disruption sites), forming transmembrane pores by cooperative insertion.
Membranolysis and necrosis The transmembrane pores disrupt membrane integrity, causing rapid loss of osmotic control and necrotic cell death — not apoptosis. Necrosis is faster than apoptosis (minutes to hours vs. days) and does not depend on any cellular signaling machinery. This is why the mechanism is independent of p53, MDR transporters, and intracellular signaling pathways: there is nothing to resist or bypass. The cell simply ruptures. The rapid 90-minute complete kill of MIA-PaCa-2 cells at 50 mcg/mL in vitro reflects this necrotic kinetics.
Intact peptide requirement Double-label fluorescence studies show intact PNC-27 (both domains co-localized) in cancer cell membrane at 30 minutes, correlating with membrane disruption. In untransformed normal cells, the peptide is seen but then degraded without causing pore formation — suggesting normal cell membranes either lack the HDM-2 docking scaffold or process the peptide before it can cluster into pores. The intact chimeric structure is required for cancer-selective killing.
Mitochondrial secondary mechanism PNC-27 can enter cancer cells and disrupt mitochondrial membranes, providing a second intracellular cytotoxic mechanism beyond plasma membrane pore formation. The mechanistic details of how PNC-27 reaches mitochondria after plasma membrane disruption or whether it independently traffics to mitochondria are not fully characterized.
p53-independence and chemotherapy resistance bypass Conventional chemotherapy drugs that damage DNA rely on an intact p53 response to trigger apoptosis in cancer cells. Tumors with p53 mutations (>50% of human cancers) are intrinsically resistant to these DNA-damage-based mechanisms. PNC-27 bypasses this entirely — its kill mechanism requires no intracellular signaling cascade. Multidrug resistance (MDR) pumps, which export hydrophilic chemotherapy molecules, are also irrelevant to a peptide that kills by membrane disruption. This makes PNC-27 theoretically effective against some of the most treatment-resistant cancer phenotypes.
Limitations of the mechanism model The entire mechanistic model is built from in vitro cell culture and single in vivo rodent studies. In vivo, the pharmacokinetics, tissue distribution, and selectivity in a complex organism with a vasculature, immune system, and heterogeneous tissues may differ substantially from cell culture predictions. The unidentified HDM-2 expression profile across the human body's normal tissues is a critical unknown — if any normal tissue expresses low levels of surface HDM-2, PNC-27 could cause off-target damage in vivo.
Evidence Index
Quantitative claims trace to these source studies. Population, dose, and study type matter — claims from HIV-lipodystrophy trials don't transfer cleanly to healthy adults; data from supraphysiologic doses doesn't apply at TRT.
50 mcg/mL PNC-27 induces 100% cancer cell death in MIA-PaCa-2 pancreatic cancer cells within 90 minutes
Cell line data; in vivo tumor response in humans is unknown and may differ substantially
Near-complete killing of leukemia and breast cancer lines
In vitro cell culture; specific dose and percentage kill not available in accessible source text
40 mg/kg intraperitoneal once daily for 2-3 weeks shows anti-tumor efficacy in vivo
Mouse AML engraftment/survival signal from product-sheet-cited research; IP dosing is not directly translatable to human SubQ protocols, and cross-species scaling conflicts with low community microgram protocols
A 46-year-old woman with end-stage metastatic cervical cancer developed massive GI hemorrhage two days after PNC-27 infusion and required 6 units packed red blood cells
Temporal association only; advanced cancer and bowel involvement provide independent hemorrhage mechanisms, so causality remains unresolved
Not medical advice. PepTutor summarizes fallible research and community signal for trained practitioners; some compounds are research-only, unapproved, controlled, jurisdiction-dependent, or labeled not for human consumption.